Structure of PDB 3jcn Chain b

Receptor sequence

>3jcnb (length=509) Species: 562 (Escherichia coli)

DTGAAAEPRAPVVTIMGHVDHGKTSLLDYIRSTKVASGEAGGITQHIGAY
HVETENGMITFLDTPGHAAFTSMRARGAQATDIVVLVVAADDGVMPQTIE
AIQHAKAAQVPVVVAVNKIDKPEADPDRVKNELSQYGILPEEWGGESQFV
HVSAKAGTGIDELLDAILLQAEVLELKAVRKGMASGAVIESFLDKGRGPV
ATVLVREGTLHKGDIVLCGFEYGRVRAMRNELGQEVLEAGPSIPVEILGL
SGVPAAGDEVTVVRDEKKAREVALYRQGKFREVKLARQQKSKLENMFANM
TEGEVHEVNIVLKADVQGSVEAISDSLLKLSTDEVKVKIIGSGVGGITET
DATLAAASNAILVGFNVRADASARKVIEAESLDLRYYSVIYNLIDEVKAA
MSGMLSPELKQQIIGLAEVRDVFKSPKFGAIAGCMVTEGVVKRHNPIRVL
RDNVVIYEGELESLRRFKDDVNEVRNGMECGIGVKNYNDVRTGDVIEVFE
IIEIQRTIA

3D structure

• PDB: 3jcn Structures of ribosome-bound initiation factor 2 reveal the mechanism of subunit association.
• Chain: b
• Resolution: 4.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b	H399 V400 Y772 R824 H825 N853 R856 N857	H18 V19 Y391 R443 H444 N472 R475 N476
BS02	rna	b	L574 D575 K576 G577 R578 G579 P580 K593 R605 R607 A608 E647 R651 T729 E730 D751 S753	L193 D194 K195 G196 R197 G198 P199 K212 R224 R226 A227 E266 R270 T348 E349 D370 S372
BS03	rna	b	F804 S806 F809 I812 S844 R846 F848	F423 S425 F428 I431 S463 R465 F467
BS04	GNP	b	V400 D401 G403 K404 T405 S406 P446 G447 K499 S534 A535 K536	V19 D20 G22 K23 T24 S25 P65 G66 K118 S153 A154 K155
BS05	FME	b	G814 C815 R847 F848 E860 C861 G862	G433 C434 R466 F467 E479 C480 G481

Gene Ontology

Molecular Function

• GO:0003743 translation initiation factor activity
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0043024 ribosomal small subunit binding
• GO:0097216 guanosine tetraphosphate binding

Biological Process

• GO:0006412 translation
• GO:0006413 translational initiation
• GO:0009409 response to cold
• GO:0061077 chaperone-mediated protein folding

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0016020 membrane

External links

• PDB: RCSB:3jcn, PDBe:3jcn, PDBj:3jcn
• PDBsum: 3jcn
• PubMed: 26973877
• UniProt: P0A705|IF2_ECOLI Translation initiation factor IF-2 (Gene Name=infB)