Structure of PDB 6snt Chain as

Receptor sequence

>6sntas (length=121) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

KALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSET
AMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKK
AYVRLTADYDALDIANRIGYI

3D structure

PDB

6snt RQT complex dissociates ribosomes collided on endogenous RQC substrate SDD1.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	as	L24 K25 T37 L38 S48 K49 H53 Y54 N55 R56 K61 K89 Y93	L3 K4 T16 L17 S27 K28 H32 Y33 N34 R35 K40 K68 Y72
BS02	rna	as	L24 R33 L34 P35 K36 K39 R42 P44 K45 Y46 S69 T71 K75 N91 K92 Y93 K109 N111 T112 V114 K120 K121 Y123 R125	L3 R12 L13 P14 K15 K18 R21 P23 K24 Y25 S48 T50 K54 N70 K71 Y72 K88 N90 T91 V93 K99 K100 Y102 R104

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6snt, PDBe:6snt, PDBj:6snt
PDBsum	6snt
PubMed	32203490
UniProt	P04456\|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)