Structure of PDB 6snt Chain ao

Receptor sequence

>6sntao (length=58) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTA
KALAAAKK

3D structure

PDB

6snt RQT complex dissociates ribosomes collided on endogenous RQC substrate SDD1.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	ao	A2 K3 S4 K5 N6 H7 T8 A9 H10 N11 Q12 T13 R14 K15 H17 R18 N19 K22 T26 Y27 K28 Y29 P30 L32 K33 D36 P37 K38 R41 N42 H43 H45 A46 G49 T50	A1 K2 S3 K4 N5 H6 T7 A8 H9 N10 Q11 T12 R13 K14 H16 R17 N18 K21 T25 Y26 K27 Y28 P29 L31 K32 D35 P36 K37 R40 N41 H42 H44 A45 G48 T49

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6snt, PDBe:6snt, PDBj:6snt
PDBsum	6snt
PubMed	32203490
UniProt	P05747\|RL29_YEAST Large ribosomal subunit protein eL29 (Gene Name=RPL29)