Structure of PDB 7pqd Chain am

Receptor sequence
>7pqdam (length=55) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
MSKFYKIWMIFDPRRVFVAQGVFLFLLAVMIHLILLSTPSYNWLEISAAK
YNRVA
3D structure
PDB7pqd Cryo-EM structure of the dimeric Rhodobacter sphaeroides RC-LH1 core complex at 2.9 angstrom : the structural basis for dimerisation.
Chainam
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SP2 am V29 H32 V29 H32
BS02 SP2 am F17 Q20 F23 L24 F17 Q20 F23 L24
BS03 BCL am L24 F25 H32 W43 L24 F25 H32 W43
BS04 SP2 am Q20 G21 Q20 G21
BS05 BCL am L24 L27 A28 I31 H32 Y41 L24 L27 A28 I31 H32 Y41
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 06:31:11 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7pqd', asym_id = 'am', title = 'Cryo-EM structure of the dimeric Rhodobacter sph...ngstrom : the structural basis for dimerisation. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7pqd', asym_id='am', title='Cryo-EM structure of the dimeric Rhodobacter sph...ngstrom : the structural basis for dimerisation. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016020,0019684,0019866,0030077,0045156', uniprot = '', pdbid = '7pqd', asym_id = 'am'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0019684,0019866,0030077,0045156', uniprot='', pdbid='7pqd', asym_id='am')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>