Structure of PDB 7pqd Chain ah

Receptor sequence
>7pqdah (length=55) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
MSKFYKIWMIFDPRRVFVAQGVFLFLLAVMIHLILLSTPSYNWLEISAAK
YNRVA
3D structure
PDB7pqd Cryo-EM structure of the dimeric Rhodobacter sphaeroides RC-LH1 core complex at 2.9 angstrom : the structural basis for dimerisation.
Chainah
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 BCL ah L24 F25 H32 W43 L24 F25 H32 W43
BS02 SP2 ah F17 Q20 L24 F17 Q20 L24
BS03 BCL ah F23 L26 F23 L26
BS04 BCL ah L24 L27 A28 I31 H32 L24 L27 A28 I31 H32
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 05:37:06 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7pqd', asym_id = 'ah', title = 'Cryo-EM structure of the dimeric Rhodobacter sph...ngstrom : the structural basis for dimerisation. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7pqd', asym_id='ah', title='Cryo-EM structure of the dimeric Rhodobacter sph...ngstrom : the structural basis for dimerisation. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016020,0019684,0019866,0030077,0045156', uniprot = '', pdbid = '7pqd', asym_id = 'ah'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0019684,0019866,0030077,0045156', uniprot='', pdbid='7pqd', asym_id='ah')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>