Structure of PDB 7o0u Chain ag

Receptor sequence
>7o0uag (length=60) Species: 1379270 (Gemmatimonas phototrophica) [Search protein sequence]
MHRIWLMYDPRRVMVALVGFLAVLALVIHFVLLSSQRYSWIENGTLGADQ
APVGASAPAA
3D structure
PDB7o0u 2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.
Chainag
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 V7N ag F20 L21 L24 F20 L21 L24
BS02 BCL ag L21 A22 A25 H29 W40 L21 A22 A25 H29 W40
BS03 V7B ag F30 S34 S35 Q36 S39 F30 S34 S35 Q36 S39
BS04 V7N ag H29 F30 H29 F30
BS05 BCL ag L24 A25 I28 H29 Y38 L24 A25 I28 H29 Y38
BS06 V7N ag M1 R3 M1 R3
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7o0u, PDBe:7o0u, PDBj:7o0u
PDBsum7o0u
PubMed35171663
UniProtA0A143BHS7

[Back to BioLiP]