Structure of PDB 7o0w Chain af

Receptor sequence
>7o0waf (length=60) Species: 1379270 (Gemmatimonas phototrophica) [Search protein sequence]
MHRIWLMYDPRRVMVALVGFLAVLALVIHFVLLSSQRYSWIENGTLGADQ
APVGASAPAA
3D structure
PDB7o0w 2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.
Chainaf
Resolution2.47 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 0V9 af L26 F30 V31 S34 L26 F30 V31 S34
BS02 V7B af F30 L33 S34 E42 F30 L33 S34 E42
BS03 BCL af V18 L21 A22 H29 W40 V18 L21 A22 H29 W40
BS04 V7B af V23 L24 V27 V23 L24 V27
BS05 BCL af M1 L21 L24 A25 I28 H29 L32 M1 L21 L24 A25 I28 H29 L32
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o0w, PDBe:7o0w, PDBj:7o0w
PDBsum7o0w
PubMed35171663
UniProtA0A143BHS7

[Back to BioLiP]