Structure of PDB 8tux Chain ab |
>8tuxab (length=127) Species: 12023 (Pseudomonas phage PP7) [Search protein sequence] |
SKTIVLSVGEATRTLTEIQSTADRQIFEEKVGPLVGRLRLTASLRQNGAK TAYRVNLKLDQADVVDCSTSVCGELPKVRYTQVWSHDVTIVANSTEASRK SLYDLTKSLVATSQVEDLVVNLVPLGR |
|
PDB | 8tux Removal of Pseudomonas Type IV Pili by a Small RNA Virus |
Chain | ab |
Resolution | 3.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
ab |
I18 L75 |
I18 L75 |
|
|
|
|