Structure of PDB 7vb9 Chain aa

Receptor sequence
>7vb9aa (length=44) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
DLGYTGLTDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF
3D structure
PDB7vb9 Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex.
Chainaa
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SPO aa E19 L20 V23 Y24 G27 L28 E14 L15 V18 Y19 G22 L23
BS02 BCL aa F31 S32 H39 W48 F49 F26 S27 H34 W43 F44
BS03 BCL aa F31 A35 H39 F26 A30 H34
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vb9, PDBe:7vb9, PDBj:7vb9
PDBsum7vb9
PubMed35418573
UniProtQ3J1A3|LHB1_CERS4 Light-harvesting protein B-875 beta chain (Gene Name=pufB)

[Back to BioLiP]