Structure of PDB 7dr2 Chain aL

Receptor sequence

>7dr2aL (length=128) Species: 2762 (Cyanophora paradoxa)

LSTPISNSSAVNGLLANLPAYRKGLTPRLRGLEIGMAHGYFLTGPFVELG
PLRNTDGGILYGSLSAVGLVVILTACLALYGKANFSGSSKSKDATLWESG
EGWSDFVSGWLIGGAGSVGFAYLLLQYI

3D structure

• PDB: 7dr2 Structural insights into an evolutionary turning-point of photosystem I from prokaryotes to eukaryotes
• Chain: aL
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	aL	I22 S23	I5 S6
BS02	CLA	aL	P62 F63 L66 G67	P45 F46 L49 G50
BS03	CLA	aL	I89 C93	I72 C76
BS04	CLA	aL	P68 Y78 S82	P51 Y61 S65
BS05	CLA	aL	N34 L35 E50 M53	N17 L18 E33 M36
BS06	CLA	aL	L35 P36 A37 I51 A54 H55 F58	L18 P19 A20 I34 A37 H38 F41
BS07	CLA	aL	Y57 F58 G61 P62 E65 L142	Y40 F41 G44 P45 E48 L125

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 06:39:00 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7dr2', asym_id = 'aL', title = 'Structural insights into an evolutionary turning...t of photosystem I from prokaryotes to eukaryotes'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7dr2', asym_id='aL', title='Structural insights into an evolutionary turning...t of photosystem I from prokaryotes to eukaryotes')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009522,0009538,0015979', uniprot = '', pdbid = '7dr2', asym_id = 'aL'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0009538,0015979', uniprot='', pdbid='7dr2', asym_id='aL')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>