Structure of PDB 7coy Chain aL

Receptor sequence

>7coyaL (length=147) Species: 329726 (Acaryochloris marina MBIC11017) [Search protein sequence]

LVKHGGDPLVGDLATPVNSSGIVKAWINNLPAYRKGMSANARGLEIGMAH
GYYLYGPFATSGPIRGTTMSLVSGVLSASAVVIVLSVAIQIYSSVSSAKP
LPSVTTADPGSDFGTKEGWSAVGSGFLIGGCGGAVIAGVLSYAIAAF

3D structure

PDB

7coy Structure of the far-red light utilizing photosystem I of Acaryochloris marina.

Chain

Resolution

2.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CL7	aL	K7 P20	K3 P16
BS02	CL7	aL	T19 V21 N22	T15 V17 N18
BS03	CL7	aL	Y57 P61 F62 S65 P67	Y53 P57 F58 S61 P63
BS04	CL7	aL	P67 S77 L80 S81 A84	P63 S73 L76 S77 A80
BS05	CL7	aL	L89 Y96	L85 Y92
BS06	CL7	aL	W30 N33 R38 E49 M52	W26 N29 R34 E45 M48
BS07	CL7	aL	W30 P35 A36 I50 H54 Y57	W26 P31 A32 I46 H50 Y53
BS08	CL7	aL	Y56 Y57 G60 T64	Y52 Y53 G56 T60
BS09	CL7	aL	S90 V91 Q94 L131	S86 V87 Q90 L127

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0016020	membrane

External links