Structure of PDB 6kmw Chain aL

Receptor sequence

>6kmwaL (length=144) Species: 1641165 (Halomicronema hongdechloris C2206) [Search protein sequence]

GHLSTPISDSAFVRSFIGNLPAYRKGMAPITRGLEIGLAHGYFLVGPEII
VGALRDYAPAPYLGGLVTAIAIVLLGTTGMGAHGLVSLKPVAESSPKTDA
LMTSEGWSEMTAGFFLGGMSGAFMAYFLLSHFSEIDAIFRGFVN

3D structure

PDB

6kmw Structural basis for the adaptation and function of chlorophyll f in photosystem I.

Chain

Resolution

2.35 Å

3D
structure

Enzymatic activity

Enzyme Commision number

1.97.1.12: photosystem I.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	aL	I22 I32	I7 I17
BS02	CLA	aL	P62 E63 V66 G67 A68	P47 E48 V51 G52 A53
BS03	CLA	aL	L90 H98	L75 H83
BS04	CLA	aL	E63 V82 T83	E48 V67 T68
BS05	CLA	aL	N34 R39 E50 L53	N19 R24 E35 L38
BS06	CLA	aL	P36 A37 I51 H55 F58	P21 A22 I36 H40 F43
BS07	CLA	aL	Y57 F58 G61 P62 I65 L143 L144 F147	Y42 F43 G46 P47 I50 L128 L129 F132
BS08	CA	aL	A68 D71	A53 D56
BS09	CLA	aL	T93 F130	T78 F115

Gene Ontology

	Molecular Function
GO:0016491	oxidoreductase activity

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0016020	membrane

External links