Structure of PDB 7dr2 Chain aK

Receptor sequence
>7dr2aK (length=69) Species: 2762 (Cyanophora paradoxa) [Search protein sequence]
TQSVGEAAEKSFVMLASVLFAGAVGGPGIKMKGQGPAWPFNAQIPFTPSE
FLAVTALGHIIGTGVILGI
3D structure
PDB7dr2 Structural insights into an evolutionary turning-point of photosystem I from prokaryotes to eukaryotes
ChainaK
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA aK I146 L153 I60 L67
BS02 CLA aK V110 G114 K116 V24 G28 K30
BS03 CLA aK S97 L101 H145 S11 L15 H59
BS04 CLA aK I146 I147 G150 G154 I60 I61 G64 G68
BS05 CLA aK A94 S97 F98 A8 S11 F12
BS06 CLA aK P125 F126 P39 F40
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 01:34:09 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7dr2', asym_id = 'aK', title = 'Structural insights into an evolutionary turning...t of photosystem I from prokaryotes to eukaryotes'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7dr2', asym_id='aK', title='Structural insights into an evolutionary turning...t of photosystem I from prokaryotes to eukaryotes')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009522,0015979,0016020,0042651', uniprot = '', pdbid = '7dr2', asym_id = 'aK'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0015979,0016020,0042651', uniprot='', pdbid='7dr2', asym_id='aK')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>