Structure of PDB 6k33 Chain aI

Receptor sequence
>6k33aI (length=38) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
MMGSYAASFLPWIFIPVVCWLMPTVVMGLLFLYIEGEA
3D structure
PDB6k33 Structure of a cyanobacterial photosystem I surrounded by octadecameric IsiA antenna proteins.
ChainaI
Resolution2.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CLA aI L10 P11 F14 V18 L10 P11 F14 V18
BS02 CLA aI C19 V26 C19 V26
BS03 CLA aI C19 W20 C19 W20
BS04 CLA aI M27 G28 M27 G28
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Dec 2 06:45:32 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6k33', asym_id = 'aI', title = 'Structure of a cyanobacterial photosystem I surrounded by octadecameric IsiA antenna proteins.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6k33', asym_id='aI', title='Structure of a cyanobacterial photosystem I surrounded by octadecameric IsiA antenna proteins.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009522,0015979', uniprot = '', pdbid = '6k33', asym_id = 'aI'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0015979', uniprot='', pdbid='6k33', asym_id='aI')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>