Structure of PDB 6k33 Chain aF

Receptor sequence
>6k33aF (length=141) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
DVAGLVPCKDSPAFQKRAAAAVNTTADPASGQKRFERYSQALCGEDGLPH
LVVDGRLSRAGDFLIPSVLFLYIAGWIGWVGRAYLIAVRNSGEANEKEII
IDVPLAIKCMLTGFAWPLAALKELASGELTAKDNEITVSPR
3D structure
PDB6k33 Structure of a cyanobacterial photosystem I surrounded by octadecameric IsiA antenna proteins.
ChainaF
Resolution2.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA aF G81 Y84 G81 Y84
BS02 CLA aF L85 E98 L85 E98
BS03 CLA aF F63 F70 F63 F70
BS04 CLA aF W76 I77 V80 M110 W76 I77 V80 M110
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 04:55:24 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6k33', asym_id = 'aF', title = 'Structure of a cyanobacterial photosystem I surrounded by octadecameric IsiA antenna proteins.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6k33', asym_id='aF', title='Structure of a cyanobacterial photosystem I surrounded by octadecameric IsiA antenna proteins.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009522,0009538,0015979', uniprot = '', pdbid = '6k33', asym_id = 'aF'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0009538,0015979', uniprot='', pdbid='6k33', asym_id='aF')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>