Structure of PDB 7y4l Chain aC

Receptor sequence

>7y4laC (length=177) Species: 35688 (Porphyridium purpureum)

MLDAFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASC
MVSDAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DASVLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERK
MSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

• PDB: 7y4l In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.
• Chain: aC
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	aC	Y74 N76	Y74 N76
BS02	PEB	aC	N35 K36 L38 D39 N42 I142 F153 A154 A155 G156 C158	N35 K36 L38 D39 N42 I142 F153 A154 A155 G156 C158
BS03	PEB	aC	N72 R77 R78 C82 R84 D85 I88 L120 V122	N72 R77 R78 C82 R84 D85 I88 L120 V122
BS04	PEB	aC	N47 C50 D54 G58 C61 I133 A136 Q137 F141 A146 T147 E148	N47 C50 D54 G58 C61 I133 A136 Q137 F141 A146 T147 E148

Gene Ontology

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030089 phycobilisome

External links

• PDB: RCSB:7y4l, PDBe:7y4l, PDBj:7y4l
• PDBsum: 7y4l
• PubMed: 36922595
• UniProt: P11393|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)