Structure of PDB 7y4l Chain a6

Receptor sequence

>7y4la6 (length=177) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

MLDAFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASC
MVSDAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DASVLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERK
MSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

PDB

7y4l In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	a6	Y74 N76 M79	Y74 N76 M79
BS02	PEB	a6	N72 C73 R77 A81 C82 R84 D85 C109 L113 L120 V122	N72 C73 R77 A81 C82 R84 D85 C109 L113 L120 V122
BS03	PEB	a6	K36 D39 I142 F153 A154 G156 C158	K36 D39 I142 F153 A154 G156 C158
BS04	PEB	a6	C50 D54 G58 C61 Q137 A140 F141 A146 T147 E148	C50 D54 G58 C61 Q137 A140 F141 A146 T147 E148

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7y4l, PDBe:7y4l, PDBj:7y4l
PDBsum	7y4l
PubMed	36922595
UniProt	P11393\|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]