Structure of PDB 8b2l Chain a3

Receptor sequence
>8b2la3 (length=91) Species: 4097 (Nicotiana tabacum) [Search protein sequence]
TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKA
VGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES
3D structure
PDB8b2l Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.
Chaina3
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna a3 T2 R4 T5 K6 K7 A8 G9 I10 G12 K13 Y14 G15 T16 R17 Y18 G19 A20 S21 R23 H34 F41 C42 K44 R49 A51 K58 Y69 T1 R3 T4 K5 K6 A7 G8 I9 G11 K12 Y13 G14 T15 R16 Y17 G18 A19 S20 R22 H33 F40 C41 K43 R48 A50 K57 Y68
BS02 ZN a3 C39 C42 C57 C60 C38 C41 C56 C59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8b2l, PDBe:8b2l, PDBj:8b2l
PDBsum8b2l
PubMed37156858
UniProtA0A1S3X5Y9

[Back to BioLiP]