Structure of PDB 7a5i Chain a3

Receptor sequence
>7a5ia3 (length=82) Species: 9606 (Homo sapiens) [Search protein sequence]
TYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPREEGPMIE
QLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
3D structure
PDB7a5i Elongational stalling activates mitoribosome-associated quality control.
Chaina3
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna a3 K120 H121 Y124 P125 H126 G127 R128 H130 R133 K134 P138 K60 H61 Y64 P65 H66 G67 R68 H70 R73 K74 P78
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a5i, PDBe:7a5i, PDBj:7a5i
PDBsum7a5i
PubMed33243891
UniProtQ9Y6G3|RM42_HUMAN Large ribosomal subunit protein mL42 (Gene Name=MRPL42)

[Back to BioLiP]