Structure of PDB 7ls2 Chain a2

Receptor sequence

>7ls2a2 (length=114) Species: 10090 (Mus musculus)

VQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPG
RLRGVRAVRPKVLMRLSKTQKHVSRAYGGSMCAKCVRDRIKRAFLIEEQK
IVVKVLKAQAQSQK

3D structure

• PDB: 7ls2 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
• Chain: a2
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a2	V2 R4 L5 T6 Y7 R8 R9 R10 L11 S12 Y13 N14 T15 S17 R21 R24 T25 P26 N28 R29 Y32 K36 K37 K40 P42 K43 V48 R54 G55 R57 R60 P61 K62 V63 M65 R66 S68 K69 T70 K72 H73 S75 R76 Y78 G80 R90 R93 A94 I97 Q112	V1 R3 L4 T5 Y6 R7 R8 R9 L10 S11 Y12 N13 T14 S16 R20 R23 T24 P25 N27 R28 Y31 K35 K36 K39 P41 K42 V47 R53 G54 R56 R59 P60 K61 V62 M64 R65 S67 K68 T69 K71 H72 S74 R75 Y77 G79 R89 R92 A93 I96 Q111

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0140236 translation at presynapse
• GO:0140242 translation at postsynapse

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005783 endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0045202 synapse
• GO:0098793 presynapse
• GO:0098794 postsynapse
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ls2, PDBe:7ls2, PDBj:7ls2
• PDBsum: 7ls2
• PubMed: 34815424
• UniProt: Q9D1R9|RL34_MOUSE Large ribosomal subunit protein eL34 (Gene Name=Rpl34)