Structure of PDB 7ls1 Chain a2

Receptor sequence

>7ls1a2 (length=114) Species: 10090 (Mus musculus) [Search protein sequence]

VQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPG
RLRGVRAVRPKVLMRLSKTQKHVSRAYGGSMCAKCVRDRIKRAFLIEEQK
IVVKVLKAQAQSQK

3D structure

PDB

7ls1 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a2	V2 R4 L5 T6 Y7 R8 R9 R10 L11 S12 Y13 N14 T15 R21 R24 T25 P26 N28 R29 Y32 Y34 K36 K37 V38 K40 P42 A45 V48 R54 G55 R57 R60 P61 K62 V63 M65 R66 K69 T70 K72 V74 S75 R76 Y78 G80 S81 R90 R93 A94 I97 Q112	V1 R3 L4 T5 Y6 R7 R8 R9 L10 S11 Y12 N13 T14 R20 R23 T24 P25 N27 R28 Y31 Y33 K35 K36 V37 K39 P41 A44 V47 R53 G54 R56 R59 P60 K61 V62 M64 R65 K68 T69 K71 V73 S74 R75 Y77 G79 S80 R89 R92 A93 I96 Q111

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0045202	synapse
GO:0098793	presynapse
GO:0098794	postsynapse
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7ls1, PDBe:7ls1, PDBj:7ls1
PDBsum	7ls1
PubMed	34815424
UniProt	Q9D1R9\|RL34_MOUSE Large ribosomal subunit protein eL34 (Gene Name=Rpl34)