Structure of PDB 5m1j Chain a2

Receptor sequence

>5m1ja2 (length=98) Species: 4932 (Saccharomyces cerevisiae)

PKKRASNGRNKKGRGHVKPVRCVNCSKSIPKDKAIKRMAIRNIVEAAAVR
DLSEASVYPEYALPKTYNKLHYCVSCAIHARIVRVRSREDRKNRAPPQ

3D structure

• PDB: 5m1j Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.
• Chain: a2
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a2	P2 K3 K4 R5 A6 N8 G9 R10 N11 K12 K13 R15 H17 P20 K28 K32 K34 K37 R38 K70 V75 S76 I79 H80 R82 R85 V86 R87 S88 R89 R92 R95	P1 K2 K3 R4 A5 N7 G8 R9 N10 K11 K12 R14 H16 P19 K27 K31 K33 K36 R37 K69 V74 S75 I78 H79 R81 R84 V85 R86 S87 R88 R91 R94
BS02	rna	a2	I41 H80	I40 H79
BS03	ZN	a2	C23 C26 C77	C22 C25 C76

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:5m1j, PDBe:5m1j, PDBj:5m1j
• PDBsum: 5m1j
• PubMed: 27995908
• UniProt: P39939|RS26B_YEAST Small ribosomal subunit protein eS26B (Gene Name=RPS26B)