Structure of PDB 7pwo Chain a1

Receptor sequence
>7pwoa1 (length=97) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]
MPVKRRNNGRSKYNCGHTNIVRCQNCHRCVPKDKVIKRFTIRNIVDNTIA
DDVLNACVIQGFAIPKLYNKVQYCVSCSIHNHIVRVRSREDRKIRTP
3D structure
PDB7pwo Cryo-EM structure of the ancient eukaryotic ribosome from the human parasite Giardia lamblia.
Chaina1
Resolution2.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna a1 M1 P2 V3 K4 R5 R6 N8 G9 R10 Y13 N14 C15 G16 H17 I20 R28 K32 K34 K37 R38 F39 K70 V75 R85 V86 R87 S88 R89 R92 R95 T96 P97 M1 P2 V3 K4 R5 R6 N8 G9 R10 Y13 N14 C15 G16 H17 I20 R28 K32 K34 K37 R38 F39 K70 V75 R85 V86 R87 S88 R89 R92 R95 T96 P97
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pwo, PDBe:7pwo, PDBj:7pwo
PDBsum7pwo
PubMed35100413
UniProtA8BQZ7

[Back to BioLiP]