Structure of PDB 8wyi Chain a

Receptor sequence

>8wyia (length=30) Species: 9606 (Homo sapiens)

LLDPKLCYLLDGILFIYGVILTALFLRVKF

3D structure

• PDB: 8wyi Structures of human gamma delta T cell receptor-CD3 complex.
• Chain: a
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	a	C32 Y33 D36 L39 F40 Y42 L46 T47 F50	C7 Y8 D11 L14 F15 Y17 L21 T22 F25

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity

Biological Process

• GO:0007166 cell surface receptor signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:8wyi, PDBe:8wyi, PDBj:8wyi
• PDBsum: 8wyi
• PubMed: 38657677
• UniProt: P20963|CD3Z_HUMAN T-cell surface glycoprotein CD3 zeta chain (Gene Name=CD247)