Structure of PDB 8s8e Chain a

Receptor sequence

>8s8ea (length=102) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

PKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNIVEAAAIR
DLSEASVYAEYALPKTYNKLHYCISCAIHARIVRVRSRTDRRIRAPPQRP
RF

3D structure

• PDB: 8s8e Structural basis of AUC codon discrimination during translation initiation in yeast.
• Chain: a
• Resolution: 3.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	P2 K3 K4 R5 A6 S7 N8 G9 R10 N11 K13 R15 G16 H17 K19 R28 K32 K34 K37 R38 I41 K70 I75 I79 H80 R82 V84 R85 R87 S88 R89 R92 R93 R95 P97 P98 P101	P1 K2 K3 R4 A5 S6 N7 G8 R9 N10 K12 R14 G15 H16 K18 R27 K31 K33 K36 R37 I40 K69 I74 I78 H79 R81 V83 R84 R86 S87 R88 R91 R92 R94 P96 P97 P100
BS02	rna	a	R42 H80 R102	R41 H79 R101
BS03	ZN	a	C23 C26 C74 C77	C22 C25 C73 C76

External links

• PDB: RCSB:8s8e, PDBe:8s8e, PDBj:8s8e
• PDBsum: 8s8e
• PubMed: 39193907
• UniProt: Q6CS01