Structure of PDB 8q7w Chain a

Receptor sequence

>8q7wa (length=81) Species: 9606 (Homo sapiens) [Search protein sequence]

KLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNRE
PVQLETLSIRGNNIRYFILPDSLPLDTLLVD

3D structure

PDB

8q7w Structural basis of human U5 snRNP late biogenesis and recycling.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	S35 G62 N63	S34 G61 N62

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000387	spliceosomal snRNP assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0006396	RNA processing
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0036261	7-methylguanosine cap hypermethylation
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0000243	commitment complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005682	U5 snRNP
GO:0005684	U2-type spliceosomal complex
GO:0005685	U1 snRNP
GO:0005686	U2 snRNP
GO:0005687	U4 snRNP
GO:0005689	U12-type spliceosomal complex
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0030532	small nuclear ribonucleoprotein complex
GO:0034709	methylosome
GO:0034715	pICln-Sm protein complex
GO:0034719	SMN-Sm protein complex
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071005	U2-type precatalytic spliceosome
GO:0071007	U2-type catalytic step 2 spliceosome
GO:0071011	precatalytic spliceosome
GO:0071013	catalytic step 2 spliceosome
GO:0097526	spliceosomal tri-snRNP complex

External links

PDB	RCSB:8q7w, PDBe:8q7w, PDBj:8q7w
PDBsum	8q7w
PubMed	38467876
UniProt	P62314\|SMD1_HUMAN Small nuclear ribonucleoprotein Sm D1 (Gene Name=SNRPD1)