Structure of PDB 8jcb Chain a

Receptor sequence
>8jcba (length=31) Species: 9606 (Homo sapiens) [Search protein sequence]
LLDPKLCYLLDGILFIYGVILTALFLRVKFS
3D structure
PDB8jcb Structures of human gamma delta T cell receptor-CD3 complex.
Chaina
Resolution9.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide a C32 Y33 D36 Y42 L46 T47 F50 C7 Y8 D11 Y17 L21 T22 F25
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
Biological Process
GO:0007166 cell surface receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jcb, PDBe:8jcb, PDBj:8jcb
PDBsum8jcb
PubMed38657677
UniProtP20963|CD3Z_HUMAN T-cell surface glycoprotein CD3 zeta chain (Gene Name=CD247)

[Back to BioLiP]