Structure of PDB 8ipx Chain a

Receptor sequence

>8ipxa (length=148) Species: 9606 (Homo sapiens)

SMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLII
RKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRI
LRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADK

3D structure

• PDB: 8ipx Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
• Chain: a
• Resolution: 4.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	S2 L4 R5 K8 R9 R16 G18 K19 K20 K21 W23 L24 S37 R38 Q39 Q40 R42 K43 K46 T56 V57 H58 S59 R60 R62 R64 R71 R74 H75 M76 I78 G79 R81 K82 G83 R88 P90 E91 K92 V93 W95 M96 R97 R100 R103 R104 R110 R117 H118 Y120 H121 Y124 L125 K128 G129 K135 H143	S1 L3 R4 K7 R8 R15 G17 K18 K19 K20 W22 L23 S36 R37 Q38 Q39 R41 K42 K45 T55 V56 H57 S58 R59 R61 R63 R70 R73 H74 M75 I77 G78 R80 K81 G82 R87 P89 E90 K91 V92 W94 M95 R96 R99 R102 R103 R109 R116 H117 Y119 H120 Y123 L124 K127 G128 K134 H142

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0045202 synapse
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ipx, PDBe:8ipx, PDBj:8ipx
• PDBsum: 8ipx
• PubMed: 37491604
• UniProt: P84098|RL19_HUMAN Large ribosomal subunit protein eL19 (Gene Name=RPL19)