Structure of PDB 8i7j Chain a

Receptor sequence

>8i7ja (length=98) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]

PKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNIVEAAAIR
DLSEASVYAEYALPKTYNKLHYCISCAIHARIVRVRSRTDRRIRAPPQ

3D structure

PDB

8i7j Yeast eukaryotic initiation factor 4B remodels the mRNA entry site on the small ribosomal subunit

Chain

Resolution

4.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	P2 K3 K4 R5 N8 R10 N11 K13 G14 R15 H17 K19 R28 K32 R38 I41 K66 I75 S76 R82 V84 R85 R87 R89 R92 R93 I94 R95 P97 Q99	P1 K2 K3 R4 N7 R9 N10 K12 G13 R14 H16 K18 R27 K31 R37 I40 K65 I74 S75 R81 V83 R84 R86 R88 R91 R92 I93 R94 P96 Q98
BS02	ZN	a	C23 C26 C74 C77	C22 C25 C73 C76

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links