Structure of PDB 8hk1 Chain a

Receptor sequence

>8hk1a (length=90) Species: 9606 (Homo sapiens) [Search protein sequence]

REEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLE
NVKEMWTEVPKKPVNKDRYISKMFLRGDSVIVVLRNPLIA

3D structure

PDB

8hk1 Mechanisms of the RNA helicases DDX42 and DDX46 in human U2 snRNP assembly.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	K88 G103 D104	K62 G77 D78

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000387	spliceosomal snRNP assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0036261	7-methylguanosine cap hypermethylation
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005682	U5 snRNP
GO:0005684	U2-type spliceosomal complex
GO:0005685	U1 snRNP
GO:0005686	U2 snRNP
GO:0005687	U4 snRNP
GO:0005689	U12-type spliceosomal complex
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0030532	small nuclear ribonucleoprotein complex
GO:0034709	methylosome
GO:0034715	pICln-Sm protein complex
GO:0034719	SMN-Sm protein complex
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0070062	extracellular exosome
GO:0071005	U2-type precatalytic spliceosome
GO:0071007	U2-type catalytic step 2 spliceosome
GO:0071011	precatalytic spliceosome
GO:0071013	catalytic step 2 spliceosome

External links

PDB	RCSB:8hk1, PDBe:8hk1, PDBj:8hk1
PDBsum	8hk1
PubMed	36797247
UniProt	P62316\|SMD2_HUMAN Small nuclear ribonucleoprotein Sm D2 (Gene Name=SNRPD2)