Structure of PDB 8fvy Chain a

Receptor sequence
>8fvya (length=96) Species: 941442 (Giardia intestinalis assemblage A) [Search protein sequence]
PVKRRNNGRSKYNCGHTNIVRCQNCHRCVPKDKVIKRFTIRNIVDNTIAD
DVLNACVIQGFAIPKLYNKVQYCVSCSIHNHIVRVRSREDRKIRTP
3D structure
PDB8fvy The Giardia lamblia ribosome structure reveals divergence in several biological pathways and the mode of emetine function
Chaina
Resolution2.94 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna a P11 K13 R14 R15 N16 N17 G18 R19 Y22 N23 C24 G25 H26 K43 K46 R47 F48 K79 V84 S85 I88 H89 V95 R96 R101 R104 P1 K3 R4 R5 N6 N7 G8 R9 Y12 N13 C14 G15 H16 K33 K36 R37 F38 K69 V74 S75 I78 H79 V85 R86 R91 R94
BS02 ZN a Q33 N34 Y82 Q23 N24 Y72
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fvy, PDBe:8fvy, PDBj:8fvy
PDBsum8fvy
PubMed38242118
UniProtA8BQZ7

[Back to BioLiP]