Structure of PDB 8etj Chain a

Receptor sequence
>8etja (length=94) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
PTHVSKTRKLRGHVWRPTVNLDRLWTLLPNEARDKYLGKNTEVAPVINVL
QSGYGKVLGKGRLPETPVIVQTRYVSRRAEEKIKQAGGVVELIA
3D structure
PDB8etj Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Chaina
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna a P2 T3 H4 S6 K7 T8 R9 K10 R12 G13 V15 T72 N74 R77 Y108 K110 L112 K114 G115 R116 S130 R131 R132 P1 T2 H3 S5 K6 T7 R8 K9 R11 G12 V14 T18 N20 R23 Y54 K56 L58 K60 G61 R62 S76 R77 R78
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0043232 intracellular non-membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8etj, PDBe:8etj, PDBj:8etj
PDBsum8etj
PubMed36423630
UniProtP36585|RL28A_SCHPO Large ribosomal subunit protein uL15A (Gene Name=rpl2802)

[Back to BioLiP]