Structure of PDB 8cku Chain a

Receptor sequence

>8ckua (length=102) Species: 4932 (Saccharomyces cerevisiae)

VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QA

3D structure

• PDB: 8cku mRNA reading frame maintenance during eukaryotic ribosome translocation
• Chain: a
• Resolution: 3.11 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	V2 N3 P5 R8 K9 T10 Y11 K13 K15 R18 K19 H20 Y28 A30 S34 F36 Q38 G39 R41 R42 R45 K46 G49 F50 G52 Q53 T54 K55 P56 V57 F58 K60 K61 A62 K63 T65 K67 V69 R80 Q82 K86 R87 C88 K89 K97 K98 K100	V1 N2 P4 R7 K8 T9 Y10 K12 K14 R17 K18 H19 Y27 A29 S33 F35 Q37 G38 R40 R41 R44 K45 G48 F49 G51 Q52 T53 K54 P55 V56 F57 K59 K60 A61 K62 T64 K66 V68 R79 Q81 K85 R86 C87 K88 K96 K97 K99
BS02	rna	a	G39 Y43 K55 P56 V57	G38 Y42 K54 P55 V56
BS03	ZN	a	C12 C17 C74 C77	C11 C16 C73 C76

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic
• GO:0046898 response to cycloheximide

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8cku, PDBe:8cku, PDBj:8cku
• PDBsum: 8cku
• PubMed: 38030725
• UniProt: P0CX27|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)