Structure of PDB 8bz1 Chain a

Receptor sequence
>8bz1a (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB8bz1 Structural basis of transcription reduction by a promoter-proximal +1 nucleosome.
Chaina
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna a H40 R41 Y42 R43 P44 T46 R73 R84 F85 S87 V118 T119 H2 R3 Y4 R5 P6 T8 R35 R46 F47 S49 V80 T81
BS02 dna a R41 Y42 G45 V47 R50 R64 K65 L66 P67 R70 R84 R3 Y4 G7 V9 R12 R26 K27 L28 P29 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8bz1, PDBe:8bz1, PDBj:8bz1
PDBsum8bz1
PubMed37148879
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]