Structure of PDB 8auv Chain a

Receptor sequence

>8auva (length=211) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

QISKKRKFVADGVFFAELNEVLTRELAEDGYSGVEVRVTPVRTEIIIRAT
RTQNVLGEKGRRIRELTSVVQKRFKFKENSVELYAEKVNNRGLCAVAQAE
SLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVIVSGKLRAQRAKSMKFK
DGYMISSGQPVKEYIDSAVRHILMRQGVLGIKVKIMLDWDPKGKQGPTTP
LPDLVTIHSPK

3D structure

PDB

8auv Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.38 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	Q7 I8 S9 K10 K11 R12 R30 K144 R146 Q148 R149 A150 K154 Y159 M160 I161 S162 S163 G164 Q165 H177 L179 R181 Q182 G183 V184 G186 K188 P208 D209	Q1 I2 S3 K4 K5 R6 R24 K138 R140 Q142 R143 A144 K148 Y153 M154 I155 S156 S157 G158 Q159 H171 L173 R175 Q176 G177 V178 G180 K182 P202 D203

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8auv, PDBe:8auv, PDBj:8auv
PDBsum	8auv
PubMed	37156858
UniProt	A0A1S4BXU2

[Back to BioLiP]