Structure of PDB 7ucj Chain a

Receptor sequence

>7ucja (length=147) Species: 9986 (Oryctolagus cuniculus)

PSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPG
YFGKVGMRHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPII
DVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKGVGGACVLVA

3D structure

• PDB: 7ucj Direct epitranscriptomic regulation of mammalian translation initiation through N4-acetylcytidine.
• Chain: a
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	P2 S3 R4 R6 K7 T8 R9 K10 R12 G13 H14 V15 S16 H17 G18 H19 G20 R21 I22 G23 H25 R26 K27 H28 P29 G31 R32 G33 N34 A35 G36 H39 H40 H41 R42 I43 N44 K47 Y52 F53 G54 K55 V56 G57 M58 R59 H60 Y61 H62 L63 K64 N66 Q67 T72 N74 V82 S83 Q85 N89 D102 R105 K110 L112 G113 K114 K116 S130 R131 R132	P1 S2 R3 R5 K6 T7 R8 K9 R11 G12 H13 V14 S15 H16 G17 H18 G19 R20 I21 G22 H24 R25 K26 H27 P28 G30 R31 G32 N33 A34 G35 H38 H39 H40 R41 I42 N43 K46 Y51 F52 G53 K54 V55 G56 M57 R58 H59 Y60 H61 L62 K63 N65 Q66 T71 N73 V81 S82 Q84 N88 D101 R104 K109 L111 G112 K113 K115 S129 R130 R131

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ucj, PDBe:7ucj, PDBj:7ucj
• PDBsum: 7ucj
• PubMed: 35679869
• UniProt: G1SNY0|RL27A_RABIT Large ribosomal subunit protein uL15 (Gene Name=RPL27A)