Structure of PDB 7qwr Chain a

Receptor sequence

>7qwra (length=147) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

PSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPG
YFGKVGMRHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPII
DVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKGVGGACVLVA

3D structure

PDB

7qwr Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	P2 S3 R4 R6 K7 T8 R9 K10 R12 G13 H14 V15 H17 G18 H19 G20 R21 I22 G23 H25 R26 K27 H28 P29 R32 G33 N34 G36 H39 H40 H41 R42 I43 N44 K47 Y52 G54 K55 V56 G57 M58 R59 H60 Y61 H62 L63 K64 Q67 T72 N74 K77 K110 L112 G113 K114 G115 K116 S130 R131 R132	P1 S2 R3 R5 K6 T7 R8 K9 R11 G12 H13 V14 H16 G17 H18 G19 R20 I21 G22 H24 R25 K26 H27 P28 R31 G32 N33 G35 H38 H39 H40 R41 I42 N43 K46 Y51 G53 K54 V55 G56 M57 R58 H59 Y60 H61 L62 K63 Q66 T71 N73 K76 K109 L111 G112 K113 G114 K115 S129 R130 R131

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7qwr, PDBe:7qwr, PDBj:7qwr
PDBsum	7qwr
PubMed	35201867
UniProt	G1SNY0\|RL27A_RABIT Large ribosomal subunit protein uL15 (Gene Name=RPL27A)