Structure of PDB 7qi5 Chain a

Receptor sequence
>7qi5a (length=100) Species: 9606 (Homo sapiens) [Search protein sequence]
TYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDHDQVL
KTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
3D structure
PDB7qi5 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
Chaina
Resolution2.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna a K120 H121 Y124 P125 H126 G127 R128 Y129 H130 R133 K134 N135 P138 K78 H79 Y82 P83 H84 G85 R86 Y87 H88 R91 K92 N93 P96
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7qi5, PDBe:7qi5, PDBj:7qi5
PDBsum7qi5
PubMed38769321
UniProtQ9Y6G3|RM42_HUMAN Large ribosomal subunit protein mL42 (Gene Name=MRPL42)

[Back to BioLiP]