Structure of PDB 7ope Chain a

Receptor sequence

>7opea (length=81) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

KKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGR
GGDDTLFAKIDGTVKFERFGRDRKKVSVYPV

3D structure

• PDB: 7ope RqcH and RqcP catalyze processive poly-alanine synthesis in a reconstituted ribosome-associated quality control system.
• Chain: a
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	K12 N20 R22 D23 S24 E25 A26 K27 R28 K32 R33 A34 D35 G36 Q37 T40 G41 G42 I44 R47 R49 G50 T51 K52 G62 G63 D64 D65 F68 F77 R84 K85	K1 N9 R11 D12 S13 E14 A15 K16 R17 K21 R22 A23 D24 G25 Q26 T29 G30 G31 I33 R36 R38 G39 T40 K41 G51 G52 D53 D54 F57 F66 R73 K74
BS02	rna	a	R79 G81 R82	R68 G70 R71
BS03	rna	a	K13 G14	K2 G3

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ope, PDBe:7ope, PDBj:7ope
• PDBsum: 7ope
• PubMed: 34255840
• UniProt: P05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)