Structure of PDB 7nwh Chain a

Receptor sequence

>7nwha (length=147) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

PSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPG
YFGKVGMRHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPII
DVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKGVGGACVLVA

3D structure

PDB

7nwh Blasticidin S inhibits mammalian translation and enhances production of protein encoded by nonsense mRNA.

Chain

Resolution

4.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	P2 S3 R4 R6 K7 R9 R12 H17 H19 R21 I22 G23 H25 R26 K27 R32 N34 G36 H40 K47 Y52 F53 K55 G57 M58 R59 H60 Y61 K64 R65 Q67 N74 Q85 T86 L112 G113 K114 K116 S130 R131	P1 S2 R3 R5 K6 R8 R11 H16 H18 R20 I21 G22 H24 R25 K26 R31 N33 G35 H39 K46 Y51 F52 K54 G56 M57 R58 H59 Y60 K63 R64 Q66 N73 Q84 T85 L111 G112 K113 K115 S129 R130

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7nwh, PDBe:7nwh, PDBj:7nwh
PDBsum	7nwh
PubMed	34157102
UniProt	G1SNY0\|RL27A_RABIT Large ribosomal subunit protein uL15 (Gene Name=RPL27A)