Structure of PDB 7nvo Chain a

Receptor sequence
>7nvoa (length=249) Species: 9606 (Homo sapiens) [Search protein sequence]
ETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKL
LEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHP
TSVISGYRLACKEAVRYINENLIVVPGGGAVEAALSIYLENYATSMGSRE
QLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLK
WIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKL
3D structure
PDB7nvo Snapshots of actin and tubulin folding inside the TRiC chaperonin.
Chaina
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP a L36 P38 D88 G89 T91 G412 L452 V503 E505 L22 P24 D74 G75 T77 G128 L168 V219 E221
BS02 AF3 a G58 A59 T90 T91 G44 A45 T76 T77
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0031625 ubiquitin protein ligase binding
GO:0044183 protein folding chaperone
GO:0051082 unfolded protein binding
GO:0140662 ATP-dependent protein folding chaperone
Biological Process
GO:0006457 protein folding
GO:0007021 tubulin complex assembly
GO:0007339 binding of sperm to zona pellucida
GO:0032212 positive regulation of telomere maintenance via telomerase
GO:0050821 protein stabilization
GO:0051086 chaperone mediated protein folding independent of cofactor
GO:0061077 chaperone-mediated protein folding
GO:0090666 scaRNA localization to Cajal body
GO:1904851 positive regulation of establishment of protein localization to telomere
GO:1904871 positive regulation of protein localization to Cajal body
GO:1904874 positive regulation of telomerase RNA localization to Cajal body
Cellular Component
GO:0000242 pericentriolar material
GO:0000792 heterochromatin
GO:0001669 acrosomal vesicle
GO:0002199 zona pellucida receptor complex
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005815 microtubule organizing center
GO:0005829 cytosol
GO:0005832 chaperonin-containing T-complex
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0044297 cell body
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nvo, PDBe:7nvo, PDBj:7nvo
PDBsum7nvo
PubMed35449234
UniProtP17987|TCPA_HUMAN T-complex protein 1 subunit alpha (Gene Name=TCP1)

[Back to BioLiP]