Structure of PDB 7k5i Chain a

Receptor sequence

>7k5ia (length=101) Species: 9606 (Homo sapiens) [Search protein sequence]

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
R

3D structure

PDB

7k5i SARS-CoV-2 Nsp1 suppresses host but not viral translation through a bipartite mechanism.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	T2 K4 R5 R6 N7 N8 G9 R10 K13 R15 G16 H17 Q19 K32 K34 K37 F39 Y68 K70 V75 I79 H80 V84 R85 R87 S88 R89 R92 R95 P97 P98 R100	T1 K3 R4 R5 N6 N7 G8 R9 K12 R14 G15 H16 Q18 K31 K33 K36 F38 Y67 K69 V74 I78 H79 V83 R84 R86 S87 R88 R91 R94 P96 P97 R99
BS02	ZN	a	C23 C26 C77	C22 C25 C76

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links

PDB	RCSB:7k5i, PDBe:7k5i, PDBj:7k5i
PDBsum	7k5i
PubMed	32995777
UniProt	P62854\|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)