Structure of PDB 7fjf Chain a

Receptor sequence
>7fjfa (length=33) Species: 9606 (Homo sapiens) [Search protein sequence]
QSFGLLDPKLCYLLDGILFIYGVILTALFLRVK
3D structure
PDB7fjf Cholesterol inhibits TCR signaling by directly restricting TCR-CD3 core tunnel motility.
Chaina
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide a F24 C32 Y33 D36 L39 F40 L46 K54 F3 C11 Y12 D15 L18 F19 L25 K33
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
Biological Process
GO:0007166 cell surface receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7fjf, PDBe:7fjf, PDBj:7fjf
PDBsum7fjf
PubMed35271814
UniProtP20963|CD3Z_HUMAN T-cell surface glycoprotein CD3 zeta chain (Gene Name=CD247)

[Back to BioLiP]