Structure of PDB 7bkd Chain a

Receptor sequence

>7bkda (length=446) Species: 323259 (Methanospirillum hungatei JF-1)

SVPVEKTAMVVGGGVAGMQAALDLASAGIKTYLIERTPTIGGRMSQLDKT
FPTLDCSQCILTPKMVDVGRHPNIEMMTYTEVEKVEGYIGNFDVTLRKKA
RGVLTPTEATAKGIVGGGCNGCGDCSAVCPVIKPNPFEMGMAPRKAIYIY
HAQVMPLIYTVDFDSCVKCGLCVEACGDKKAIDLEMQDEFITVKVGTAVL
ATGYELFPIENKREWGYKQFDNVINALEFERLICASGPTGGHLVRPSDGK
TPMKVGFVLCAGSRDNTGIGKPYCSRFCCMYSLKHAHQIMEKIPGAVAYL
FYMDIRSFGKMYEEFYYRIQHEGAKFIRGRVANVLEDKETKNLHVFTEDT
LLGRPVDVEVDLLVLAAAVQPNEGANELRKKFGVSASQDGWMLEAHPKLN
PCGTTTAGVFLAGVCQGPKDIPDTVAQAEGAASAASIPIHMGEVEL

3D structure

• PDB: 7bkd Three-megadalton complex of methanogenic electron-bifurcating and CO 2 -fixing enzymes.
• Chain: a
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 1.8.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	a	L401 C402 S405 C416 S417 R418 F419 C420 C421 R448	L259 C260 S263 C274 S275 R276 F277 C278 C279 R306
BS02	FAD	a	G156 V157 E177 R178 G184 R185 L189 T192 F193 T344 G345 Y346 Y423 K426 V556 I563	G14 V15 E35 R36 G42 R43 L47 T50 F51 T202 G203 Y204 Y281 K284 V414 I421
BS03	SF4	a	C261 G263 C264 G265 C267 Y301 C318 K321	C119 G121 C122 G123 C125 Y159 C176 K179
BS04	SF4	a	C271 P272 A288 I289 C308 V309 K310 C311 G312 C314	C129 P130 A146 I147 C166 V167 K168 C169 G170 C172

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

External links

• PDB: RCSB:7bkd, PDBe:7bkd, PDBj:7bkd
• PDBsum: 7bkd
• PubMed: 34516836
• UniProt: Q2FKZ1