Structure of PDB 7as9 Chain a

Receptor sequence
>7as9a (length=75) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
TKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGDDTL
FAKIDGTVKFERFGRDRKKVSVYPV
3D structure
PDB7as9 Structural Basis for Bacterial Ribosome-Associated Quality Control by RqcH and RqcP.
Chaina
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna a N20 R22 D23 S24 E25 A26 K27 R28 K32 R33 A34 D35 Q37 G41 G42 S43 I44 R49 G50 T51 G62 G63 D64 F77 R84 K85 N3 R5 D6 S7 E8 A9 K10 R11 K15 R16 A17 D18 Q20 G24 G25 S26 I27 R32 G33 T34 G45 G46 D47 F60 R67 K68
BS02 rna a R79 G81 R82 R62 G64 R65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7as9, PDBe:7as9, PDBj:7as9
PDBsum7as9
PubMed33259810
UniProtP05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]