Structure of PDB 6zsd Chain a

Receptor sequence
>6zsda (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]
TYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPEETHDQVL
KTRLEEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
3D structure
PDB6zsd Structural basis of mitochondrial translation.
Chaina
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna a H121 Y124 P125 H126 G127 R128 H130 R133 K134 N135 P138 H76 Y79 P80 H81 G82 R83 H85 R88 K89 N90 P93
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zsd, PDBe:6zsd, PDBj:6zsd
PDBsum6zsd
PubMed32812867
UniProtQ9Y6G3|RM42_HUMAN Large ribosomal subunit protein mL42 (Gene Name=MRPL42)

[Back to BioLiP]