Structure of PDB 6zoj Chain a

Receptor sequence

>6zoja (length=101) Species: 9606 (Homo sapiens) [Search protein sequence]

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
R

3D structure

PDB

6zoj SARS-CoV-2 Nsp1 binds the ribosomal mRNA channel to inhibit translation.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	T2 K3 K4 R5 R6 N7 N8 G9 R10 K12 K13 R15 G16 H17 K32 K34 F39 I41 Y68 V75 S76 I79 H80 K82 V83 V84 R87 S88 R89 R92 R95 P97 P98 R100 F101	T1 K2 K3 R4 R5 N6 N7 G8 R9 K11 K12 R14 G15 H16 K31 K33 F38 I40 Y67 V74 S75 I78 H79 K81 V82 V83 R86 S87 R88 R91 R94 P96 P97 R99 F100
BS02	ZN	a	C23 C26 C77	C22 C25 C76

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links

PDB	RCSB:6zoj, PDBe:6zoj, PDBj:6zoj
PDBsum	6zoj
PubMed	32908316
UniProt	P62854\|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)