Structure of PDB 6ywe Chain a

Receptor sequence

>6ywea (length=161) Species: 5141 (Neurospora crassa) [Search protein sequence]

QSTANRTKRMLNIPPHESFLNVPVEGDRIIFNPPSSEASVYHTPFKFLPR
SDPRRRANIYKLFDLPPVLYNPTKSYNVTPEQVEEIRELRAKDPKKYSVT
YLSNKYNCTKVFIMMCTQAPREHQEQHKLARARTAENWGPRRAAAKLDAR
RRKEMLHRGEI

3D structure

PDB

6ywe Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.

Chain

Resolution

2.99 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	Q41 T43 A44 R46 T47 K48 R49 M50 N52 P55 Y134 T137 K138 S139 Y140 R154 S162 V163 T164 N171 T173 K174 V175 F176 M178 M179 Q182 R185 Q188 H191 K192 R195 N201 W202 G203 R205 R206 A209 K210 R214 K217	Q1 T3 A4 R6 T7 K8 R9 M10 N12 P15 Y70 T73 K74 S75 Y76 R90 S98 V99 T100 N107 T109 K110 V111 F112 M114 M115 Q118 R121 Q124 H127 K128 R131 N137 W138 G139 R141 R142 A145 K146 R150 K153

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Cellular Component
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6ywe, PDBe:6ywe, PDBj:6ywe
PDBsum	6ywe
PubMed	33056988
UniProt	Q8NIR6

[Back to BioLiP]