Structure of PDB 6wqq Chain a

Receptor sequence
>6wqqa (length=110) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
KIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTL
AQASSKTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALA
EAARESGLEF
3D structure
PDB6wqq Characterization of the Core Ribosomal Binding Region for the Oxazolidone Family of Antibiotics Using Cryo-EM.
Chaina
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna a A16 R17 A26 F94 R96 Y101 R113 A13 R14 A23 F85 R87 Y92 R104
BS02 rna a K4 D6 K7 R11 R19 N32 Y34 S36 N37 K38 H39 Q43 V51 T52 Q55 A67 T68 V70 H102 G103 K1 D3 K4 R8 R16 N29 Y31 S33 N34 K35 H36 Q40 V48 T49 Q52 A58 T59 V61 H93 G94
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wqq, PDBe:6wqq, PDBj:6wqq
PDBsum6wqq
PubMed32566908
UniProtQ2FW22|RL18_STAA8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]