Structure of PDB 6wdj Chain a

Receptor sequence
>6wdja (length=134) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
KLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGIDA
RKSDQNVRGATVLPHGTGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEA
LLVALKKAKPTQAKGVYIKKVSISTTMGAGVAVD
3D structure
PDB6wdj Cryo-EM of elongating ribosome with EF-Tu•GTP elucidates tRNA proofreading.
Chaina
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna a K3 K6 R7 M8 R12 A36 K37 F38 S41 D43 A45 N47 I170 H172 K205 G206 K211 T217 M218 G219 A220 K1 K4 R5 M6 R10 A34 K35 F36 S39 D41 A43 N45 I79 H81 K114 G115 K120 T126 M127 G128 A129
BS02 rna a R53 K54 R51 K52
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0045947 negative regulation of translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wdj, PDBe:6wdj, PDBj:6wdj
PDBsum6wdj
PubMed32612237
UniProtP0A7L0|RL1_ECOLI Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]